PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676714756
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family EIL
Protein Properties Length: 425aa    MW: 48183.3 Da    PI: 5.3357
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676714756genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3257.85.2e-796329056288
                XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSS CS
       EIN3  56 iLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhc 155
                i kYM+k+m v++aqGfv+giipekgkpv +asd+L+ WW+ +v+fd ngpaai+kyq k  + +g+++           l++lqD tlg +Lsalm hc
  676714756  63 ISKYMFKMMDVYKAQGFVFGIIPEKGKPVISASDNLKDWWRHEVRFDVNGPAAIAKYQEKSKMIHGGNDG-----LVGRLLQDLQDPTLGWILSALMPHC 157
                78*******************************************************7776666655555.....34678******************** PP

                SS-TTS--TTT--HHHH---S--HHHHHHT--TT--..-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTT CS
       EIN3 156 dppqrrfplekgvepPWWPtGkelwwgelglskdqg.tppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqee 254
                dppqr fp ekg++p WWPtGke ww+     +dqg +ppykkphdl+k wk+ vLt+ ikh+sp   ++re   +s +lq+kmsake++ +l  +nqee
  676714756 158 DPPQRWFPFEKGIKPQWWPTGKESWWP-----QDQGpAPPYKKPHDLRKTWKILVLTSIIKHLSPG--RVREIISRSNSLQTKMSAKETDSWLHMINQEE 250
                ***************************.....99999***************************98..******************************** PP

                T-S--XXXX.XX.....XXXX.XXXXXXXXXXXXXXXXXXX CS
       EIN3 255 kecatvsah.ss.....slrk.qspkvtlsceqkedvegkk 288
                +  ++ + + s+      +r  ++++v +s++++  ++  +
  676714756 251 ASSHDNMLNtSNvemvkPHRMgKRKAVSISEGTE-GRDHSE 290
                9887666653335555533333555666666644.333222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.8E-7962250No hitNo description
Gene3DG3DSA:1.10.3180.105.9E-48137256IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167689.94E-43137251IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MGTPSNTGSS FSEPYSIVDE GDGYTDDEVD IDELEKKIWR QEMRLKRLKG HGKTKERIDM  60
QEISKYMFKM MDVYKAQGFV FGIIPEKGKP VISASDNLKD WWRHEVRFDV NGPAAIAKYQ  120
EKSKMIHGGN DGLVGRLLQD LQDPTLGWIL SALMPHCDPP QRWFPFEKGI KPQWWPTGKE  180
SWWPQDQGPA PPYKKPHDLR KTWKILVLTS IIKHLSPGRV REIISRSNSL QTKMSAKETD  240
SWLHMINQEE ASSHDNMLNT SNVEMVKPHR MGKRKAVSIS EGTEGRDHSE INLISEDTNS  300
SENHQTAFPN LECLFADGAS SNFRVNDVST PMFLPLNSVQ QAIDGSGFGY NGDMQNMIDE  360
LMPMIEGNIN KNQISSVVEN DKSVTLQPEA RDQQEHMHFC PVEGDSAETS IVEVLMNIAN  420
SDSYV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_B2e-451382556129Protein ETHYLENE INSENSITIVE 3
4zds_A2e-451382556129Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013723651.11e-141PREDICTED: protein ETHYLENE INSENSITIVE 3-like
SwissprotO246061e-113EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0D3BMK01e-137A0A0D3BMK0_BRAOL; Uncharacterized protein
STRINGAT3G20770.11e-111(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1878878
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.11e-114EIL family protein